Spaces:
Runtime error
Runtime error
| import gradio as gr | |
| import torch | |
| from fuse.data.tokenizers.modular_tokenizer.op import ModularTokenizerOp | |
| from mammal.model import Mammal | |
| from mammal.keys import * | |
| model_path="ibm/biomed.omics.bl.sm.ma-ted-400m" | |
| # Load Model | |
| model = Mammal.from_pretrained(model_path) | |
| model.eval() | |
| # Load Tokenizer | |
| tokenizer_op = ModularTokenizerOp.from_pretrained(model_path) | |
| #token for positive binding | |
| positive_token_id=tokenizer_op.get_token_id("<1>") | |
| # Default input proteins | |
| protein_calmodulin = "MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMISELDQDGFIDKEDLHDGDGKISFEEFLNLVNKEMTADVDGDGQVNYEEFVTMMTSK" | |
| protein_calcineurin = "MSSKLLLAGLDIERVLAEKNFYKEWDTWIIEAMNVGDEEVDRIKEFKEDEIFEEAKTLGTAEMQEYKKQKLEEAIEGAFDIFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIRQMWDQNGDWDRIKELKFGEIKKLSAKDTRGTIFIKVFENLGTGVDSEYEDVSKYMLKHQ" | |
| def format_prompt(prot1,prot2): | |
| # Formatting prompt to match pre-training syntax | |
| return f"<@TOKENIZER-TYPE=AA><BINDING_AFFINITY_CLASS><SENTINEL_ID_0><MOLECULAR_ENTITY><MOLECULAR_ENTITY_GENERAL_PROTEIN><SEQUENCE_NATURAL_START>{prot1}<SEQUENCE_NATURAL_END><MOLECULAR_ENTITY><MOLECULAR_ENTITY_GENERAL_PROTEIN><SEQUENCE_NATURAL_START>{prot2}<SEQUENCE_NATURAL_END><EOS>" | |
| def run_prompt(prompt): | |
| # Create and load sample | |
| sample_dict = dict() | |
| sample_dict[ENCODER_INPUTS_STR] = prompt | |
| # Tokenize | |
| sample_dict=tokenizer_op( | |
| sample_dict=sample_dict, | |
| key_in=ENCODER_INPUTS_STR, | |
| key_out_tokens_ids=ENCODER_INPUTS_TOKENS, | |
| key_out_attention_mask=ENCODER_INPUTS_ATTENTION_MASK, | |
| ) | |
| sample_dict[ENCODER_INPUTS_TOKENS] = torch.tensor(sample_dict[ENCODER_INPUTS_TOKENS]) | |
| sample_dict[ENCODER_INPUTS_ATTENTION_MASK] = torch.tensor(sample_dict[ENCODER_INPUTS_ATTENTION_MASK]) | |
| # Generate Prediction | |
| batch_dict = model.generate( | |
| [sample_dict], | |
| output_scores=True, | |
| return_dict_in_generate=True, | |
| max_new_tokens=5, | |
| ) | |
| # Get output | |
| generated_output = tokenizer_op._tokenizer.decode(batch_dict[CLS_PRED][0]) | |
| score = batch_dict['model.out.scores'][0][1][positive_token_id].item() | |
| return generated_output,score | |
| def create_and_run_prompt(prot1, prot2): | |
| prompt = format_prompt(prot1, prot2) | |
| res=prompt, *run_prompt(prompt=prompt) | |
| return res | |
| def create_application(): | |
| markup_text = f""" | |
| # Mammal based Protein-Protein Interaction (PPI) demonstration | |
| Given two protein sequences, estimate if the proteins interact or not. | |
| ### Using the model from | |
| ```{model_path} ``` | |
| """ | |
| with gr.Blocks() as demo: | |
| gr.Markdown(markup_text) | |
| with gr.Row(): | |
| prot1 = gr.Textbox( | |
| label="Protein 1 sequence", | |
| # info="standard", | |
| interactive=True, | |
| lines=1, | |
| value=protein_calmodulin, | |
| ) | |
| prot2 = gr.Textbox( | |
| label="Protein 2 sequence", | |
| # info="standard", | |
| interactive=True, | |
| lines=1, | |
| value=protein_calcineurin, | |
| ) | |
| with gr.Row(): | |
| run_mammal = gr.Button("Run Mammal prompt for Protein-Protein Interaction",variant='primary') | |
| with gr.Row(): | |
| prompt_box = gr.Textbox(label="Mammal prompt",lines=5) | |
| with gr.Row(): | |
| decoded = gr.Textbox(label="Mammal output") | |
| run_mammal.click( | |
| fn=create_and_run_prompt, | |
| inputs=[prot1,prot2], | |
| outputs=[prompt_box,decoded,gr.Number(label='PPI score')] | |
| ) | |
| with gr.Row(): | |
| gr.Markdown("```<SENTINEL_ID_0>``` contains the binding affinity class, which is ```<1>``` for interating and ```<0>``` for non-interating") | |
| return demo | |
| def main(): | |
| demo = create_application() | |
| demo.launch(show_error=True, share=True) | |
| if __name__ == "__main__": | |
| main() | |