wording in tcr

mammal_demo/tcr_task.py

@@ -16,15 +16,15 @@ from mammal_demo.demo_framework import MammalObjectBroker, MammalTask
 class TcrTask(MammalTask):
     def __init__(self, model_dict):
         super().__init__(
-            name="Mammal based TCRbeta-epitope binding affinity", model_dict=model_dict
+            name="TCRbeta-epitope binding affinity", model_dict=model_dict
         )
-        self.description = "Mammal based TCRbeta-epitope binding affinity (TCR)"
+        self.description = "TCRbeta-epitope binding affinity (TCR)"
         self.examples = {
             "tcr_beta_seq": "NAGVTQTPKFQVLKTGQSMTLQCAQDMNHEYMSWYRQDPGMGLRLIHYSVGAGITDQGEVPNGYNVSRSTTEDFPLRLLSAAPSQTSVYFCASSYSWDRVLEQYFGPGTRLTVT",
             "epitope_seq": "LLQTGIHVRVSQPSL",
         }
         self.markup_text = """
-# Mammal based Mammal based TCRbeta-epitope binding affinity demonstration
+# Mammal based TCRbeta-epitope binding affinity demonstration
 
 Given a TCR beta chain and epitope amino acid sequences, estimate the binding affinity score.
 """