|
|
import numpy as np |
|
|
import torch |
|
|
import torch.nn as nn |
|
|
import torch.nn.functional as F |
|
|
from torch.utils.data import Dataset, DataLoader |
|
|
from sklearn.model_selection import train_test_split |
|
|
from sklearn.metrics import accuracy_score, f1_score |
|
|
from scipy.stats import spearmanr |
|
|
from collections import defaultdict |
|
|
import pandas as pd |
|
|
import logging |
|
|
import os |
|
|
import torch.optim as optim |
|
|
from datetime import datetime |
|
|
from transformers import AutoModel, AutoConfig, AutoTokenizer |
|
|
class UnpooledBindingPredictor(nn.Module): |
|
|
def __init__(self, |
|
|
esm_model_name="facebook/esm2_t33_650M_UR50D", |
|
|
hidden_dim=512, |
|
|
kernel_sizes=[3, 5, 7], |
|
|
n_heads=8, |
|
|
n_layers=3, |
|
|
dropout=0.1, |
|
|
freeze_esm=True): |
|
|
super().__init__() |
|
|
|
|
|
|
|
|
self.tight_threshold = 7.5 |
|
|
self.weak_threshold = 6.0 |
|
|
|
|
|
|
|
|
self.esm_model = AutoModel.from_pretrained(esm_model_name) |
|
|
self.config = AutoConfig.from_pretrained(esm_model_name) |
|
|
|
|
|
|
|
|
if freeze_esm: |
|
|
for param in self.esm_model.parameters(): |
|
|
param.requires_grad = False |
|
|
|
|
|
|
|
|
esm_dim = self.config.hidden_size |
|
|
|
|
|
|
|
|
output_channels_per_kernel = 64 |
|
|
|
|
|
|
|
|
self.protein_conv_layers = nn.ModuleList([ |
|
|
nn.Conv1d( |
|
|
in_channels=esm_dim, |
|
|
out_channels=output_channels_per_kernel, |
|
|
kernel_size=k, |
|
|
padding='same' |
|
|
) for k in kernel_sizes |
|
|
]) |
|
|
|
|
|
self.binder_conv_layers = nn.ModuleList([ |
|
|
nn.Conv1d( |
|
|
in_channels=esm_dim, |
|
|
out_channels=output_channels_per_kernel, |
|
|
kernel_size=k, |
|
|
padding='same' |
|
|
) for k in kernel_sizes |
|
|
]) |
|
|
|
|
|
|
|
|
total_features_per_seq = output_channels_per_kernel * len(kernel_sizes) * 2 |
|
|
|
|
|
|
|
|
self.protein_projection = nn.Linear(total_features_per_seq, hidden_dim) |
|
|
self.binder_projection = nn.Linear(total_features_per_seq, hidden_dim) |
|
|
|
|
|
self.protein_norm = nn.LayerNorm(hidden_dim) |
|
|
self.binder_norm = nn.LayerNorm(hidden_dim) |
|
|
|
|
|
|
|
|
self.cross_attention_layers = nn.ModuleList([ |
|
|
nn.ModuleDict({ |
|
|
'attention': nn.MultiheadAttention(hidden_dim, n_heads, dropout=dropout), |
|
|
'norm1': nn.LayerNorm(hidden_dim), |
|
|
'ffn': nn.Sequential( |
|
|
nn.Linear(hidden_dim, hidden_dim * 4), |
|
|
nn.ReLU(), |
|
|
nn.Dropout(dropout), |
|
|
nn.Linear(hidden_dim * 4, hidden_dim) |
|
|
), |
|
|
'norm2': nn.LayerNorm(hidden_dim) |
|
|
}) for _ in range(n_layers) |
|
|
]) |
|
|
|
|
|
|
|
|
self.shared_head = nn.Sequential( |
|
|
nn.Linear(hidden_dim * 2, hidden_dim), |
|
|
nn.ReLU(), |
|
|
nn.Dropout(dropout), |
|
|
) |
|
|
|
|
|
|
|
|
self.regression_head = nn.Linear(hidden_dim, 1) |
|
|
|
|
|
|
|
|
self.classification_head = nn.Linear(hidden_dim, 3) |
|
|
|
|
|
def get_binding_class(self, affinity): |
|
|
"""Convert affinity values to class indices |
|
|
0: tight binding (>= 7.5) |
|
|
1: medium binding (6.0-7.5) |
|
|
2: weak binding (< 6.0) |
|
|
""" |
|
|
if isinstance(affinity, torch.Tensor): |
|
|
tight_mask = affinity >= self.tight_threshold |
|
|
weak_mask = affinity < self.weak_threshold |
|
|
medium_mask = ~(tight_mask | weak_mask) |
|
|
|
|
|
classes = torch.zeros_like(affinity, dtype=torch.long) |
|
|
classes[medium_mask] = 1 |
|
|
classes[weak_mask] = 2 |
|
|
return classes |
|
|
else: |
|
|
if affinity >= self.tight_threshold: |
|
|
return 0 |
|
|
elif affinity < self.weak_threshold: |
|
|
return 2 |
|
|
else: |
|
|
return 1 |
|
|
|
|
|
def compute_embeddings(self, input_ids, attention_mask=None): |
|
|
"""Compute ESM embeddings on the fly""" |
|
|
esm_outputs = self.esm_model( |
|
|
input_ids=input_ids, |
|
|
attention_mask=attention_mask, |
|
|
return_dict=True |
|
|
) |
|
|
|
|
|
|
|
|
return esm_outputs.last_hidden_state |
|
|
|
|
|
def process_sequence(self, unpooled_emb, conv_layers, attention_mask=None): |
|
|
"""Process a sequence through CNN layers and pooling""" |
|
|
|
|
|
x = unpooled_emb.transpose(1, 2) |
|
|
|
|
|
|
|
|
conv_outputs = [] |
|
|
for conv in conv_layers: |
|
|
conv_out = F.relu(conv(x)) |
|
|
conv_outputs.append(conv_out) |
|
|
|
|
|
|
|
|
conv_output = torch.cat(conv_outputs, dim=1) |
|
|
|
|
|
|
|
|
|
|
|
if attention_mask is not None: |
|
|
|
|
|
|
|
|
expanded_mask = attention_mask.unsqueeze(1).expand(-1, conv_output.size(1), -1) |
|
|
|
|
|
|
|
|
masked_output = conv_output.clone() |
|
|
masked_output = masked_output.masked_fill(expanded_mask == 0, float('-inf')) |
|
|
|
|
|
|
|
|
max_pooled = torch.max(masked_output, dim=2)[0] |
|
|
|
|
|
|
|
|
sum_pooled = torch.sum(conv_output * expanded_mask, dim=2) |
|
|
valid_positions = torch.sum(expanded_mask, dim=2) |
|
|
valid_positions = torch.clamp(valid_positions, min=1.0) |
|
|
avg_pooled = sum_pooled / valid_positions |
|
|
else: |
|
|
|
|
|
max_pooled = torch.max(conv_output, dim=2)[0] |
|
|
avg_pooled = torch.mean(conv_output, dim=2) |
|
|
|
|
|
|
|
|
pooled = torch.cat([max_pooled, avg_pooled], dim=1) |
|
|
|
|
|
return pooled |
|
|
|
|
|
def forward(self, protein_input_ids, binder_input_ids, protein_mask=None, binder_mask=None): |
|
|
|
|
|
protein_unpooled = self.compute_embeddings(protein_input_ids, protein_mask) |
|
|
binder_unpooled = self.compute_embeddings(binder_input_ids, binder_mask) |
|
|
|
|
|
|
|
|
protein_features = self.process_sequence(protein_unpooled, self.protein_conv_layers, protein_mask) |
|
|
binder_features = self.process_sequence(binder_unpooled, self.binder_conv_layers, binder_mask) |
|
|
|
|
|
|
|
|
protein = self.protein_norm(self.protein_projection(protein_features)) |
|
|
binder = self.binder_norm(self.binder_projection(binder_features)) |
|
|
|
|
|
|
|
|
protein = protein.unsqueeze(0) |
|
|
binder = binder.unsqueeze(0) |
|
|
|
|
|
|
|
|
for layer in self.cross_attention_layers: |
|
|
|
|
|
attended_protein = layer['attention']( |
|
|
protein, binder, binder |
|
|
)[0] |
|
|
protein = layer['norm1'](protein + attended_protein) |
|
|
protein = layer['norm2'](protein + layer['ffn'](protein)) |
|
|
|
|
|
|
|
|
attended_binder = layer['attention']( |
|
|
binder, protein, protein |
|
|
)[0] |
|
|
binder = layer['norm1'](binder + attended_binder) |
|
|
binder = layer['norm2'](binder + layer['ffn'](binder)) |
|
|
|
|
|
|
|
|
protein_pool = protein.squeeze(0) |
|
|
binder_pool = binder.squeeze(0) |
|
|
|
|
|
|
|
|
combined = torch.cat([protein_pool, binder_pool], dim=-1) |
|
|
|
|
|
|
|
|
shared_features = self.shared_head(combined) |
|
|
|
|
|
regression_output = self.regression_head(shared_features) |
|
|
classification_logits = self.classification_head(shared_features) |
|
|
|
|
|
return regression_output, classification_logits |
|
|
|
|
|
def load_model(checkpoint_path, device): |
|
|
"""Load trained model from checkpoint.""" |
|
|
checkpoint = torch.load(checkpoint_path, map_location=device) |
|
|
|
|
|
|
|
|
|
|
|
model = UnpooledBindingPredictor( |
|
|
esm_model_name="facebook/esm2_t33_650M_UR50D", |
|
|
hidden_dim=384, |
|
|
kernel_sizes=[3, 5, 7], |
|
|
n_heads=8, |
|
|
n_layers=4, |
|
|
dropout=0.14561457009902096, |
|
|
freeze_esm=True |
|
|
).to(device) |
|
|
|
|
|
|
|
|
model.load_state_dict(checkpoint['model_state_dict']) |
|
|
model.eval() |
|
|
|
|
|
return model |
|
|
|
|
|
|
|
|
def prepare_inputs(protein_sequence, binder_sequence, tokenizer, max_length=1024, device='cuda'): |
|
|
"""Tokenize protein and binder sequences.""" |
|
|
protein_tokens = tokenizer( |
|
|
protein_sequence, |
|
|
return_tensors="pt", |
|
|
padding="max_length", |
|
|
max_length=max_length, |
|
|
truncation=True |
|
|
) |
|
|
|
|
|
binder_tokens = tokenizer( |
|
|
binder_sequence, |
|
|
return_tensors="pt", |
|
|
padding="max_length", |
|
|
max_length=max_length, |
|
|
truncation=True |
|
|
) |
|
|
|
|
|
return { |
|
|
'protein_input_ids': protein_tokens['input_ids'].to(device), |
|
|
'protein_attention_mask': protein_tokens['attention_mask'].to(device), |
|
|
'binder_input_ids': binder_tokens['input_ids'].to(device), |
|
|
'binder_attention_mask': binder_tokens['attention_mask'].to(device) |
|
|
} |
|
|
|
|
|
|
|
|
def predict_binding(model, protein_sequence, binder_sequence, device='cuda'): |
|
|
"""Predict binding affinity between protein and binder sequences.""" |
|
|
tokenizer = AutoTokenizer.from_pretrained("facebook/esm2_t33_650M_UR50D") |
|
|
inputs = prepare_inputs(protein_sequence, binder_sequence, tokenizer, device=device) |
|
|
|
|
|
with torch.no_grad(): |
|
|
regression_output, classification_logits = model( |
|
|
inputs['protein_input_ids'], |
|
|
inputs['binder_input_ids'], |
|
|
inputs['protein_attention_mask'], |
|
|
inputs['binder_attention_mask'] |
|
|
) |
|
|
|
|
|
|
|
|
predicted_affinity = regression_output.item() |
|
|
|
|
|
|
|
|
predicted_class_idx = torch.argmax(classification_logits, dim=1).item() |
|
|
class_names = ['Tight binding', 'Medium binding', 'Weak binding'] |
|
|
predicted_class = class_names[predicted_class_idx] |
|
|
|
|
|
|
|
|
class_probs = F.softmax(classification_logits, dim=1).cpu().numpy()[0] |
|
|
|
|
|
return { |
|
|
'predicted_affinity': predicted_affinity, |
|
|
'binding_class': predicted_class, |
|
|
'class_probabilities': {name: prob for name, prob in zip(class_names, class_probs)}, |
|
|
'tight_threshold': model.tight_threshold, |
|
|
'weak_threshold': model.weak_threshold |
|
|
} |
|
|
|
|
|
|
|
|
if __name__ == "__main__": |
|
|
|
|
|
device = torch.device('cuda' if torch.cuda.is_available() else 'cpu') |
|
|
|
|
|
|
|
|
model = load_model('../classifier_ckpt/binding_affinity_unpooled.pt', device) |
|
|
|
|
|
protein_sequence = "GSHMIEPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAV" |
|
|
binder_sequence = "VVKVDSV" |
|
|
|
|
|
result = predict_binding(model, protein_sequence, binder, device) |
|
|
print(f"Affinity Score: {result['predicted_affinity']}") |
|
|
|