AhmedElTaher's picture
Upload 45 files
57bef45 verified

A newer version of the Gradio SDK is available: 5.49.1

Upgrade
metadata
title: AbMelt Complete MD Pipeline
emoji: 🧬
colorFrom: blue
colorTo: purple
sdk: gradio
sdk_version: 5.46.1
app_file: app.py
pinned: false

AbMelt: Complete Molecular Dynamics Pipeline for Antibody Thermostability Prediction

This Hugging Face Space implements the complete AbMelt protocol for predicting antibody thermostability through multi-temperature molecular dynamics simulations.

Features

  • Complete MD Pipeline: From sequence to thermostability predictions
  • Structure Generation: ImmuneBuilder for Fv structure prediction
  • Multi-temperature Simulations: 300K, 350K, 400K molecular dynamics
  • Comprehensive Analysis: GROMACS + MDAnalysis descriptor calculations
  • ML Predictions: Random Forest models for Tagg, Tm,on, and Tm

Quick Start

Local Testing

# 1. Validate the pipeline
python run_local.py test

# 2. View example sequences
python run_local.py examples

# 3. Start the web interface
python run_local.py run

Docker Usage

# Build and run with Docker
docker build -t abmelt-pipeline .
docker run -p 7860:7860 abmelt-pipeline

Open your browser to http://localhost:7860

Usage

  1. Input heavy and light chain variable region sequences
  2. Configure simulation parameters (start with 10ns for testing)
  3. Wait for complete MD simulation pipeline (30 minutes to 4+ hours)
  4. Download thermostability predictions and intermediate files

Example Sequences

Use these for testing:

Quick Test (Short sequences for 10ns runs):

  • Heavy: QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPSGGSTNYAQKFQGRVTMTRDTSASTAYMELSSLRSEDTAVYYCAR
  • Light: DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYST

File Structure

AbMelt_HF_Space/
β”œβ”€β”€ app.py                    # Main Gradio application
β”œβ”€β”€ run_local.py             # Local testing script
β”œβ”€β”€ test_pipeline.py         # Validation tests
β”œβ”€β”€ src/                     # Pipeline modules
β”œβ”€β”€ mdp_templates/           # GROMACS simulation templates
β”œβ”€β”€ models/                  # Pre-trained ML models
└── data/                    # Example data and sequences

Requirements

  • System: GROMACS, Python 3.8+, 8GB+ RAM
  • Time: 30 minutes (10ns) to 4+ hours (100ns)
  • Hardware: CPU with 4+ cores recommended

Note

This Space runs complete molecular dynamics simulations. Due to computational requirements, simulations may take several hours to complete.